DPCstruct | MC26581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 227 ± 41 aa |
| Standard deviation of domain lengths | 41.11 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12246 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067N5K8 | 10-221 | HTAIKASRVNDKFQDPLYLFLELVRAGVMHGNLWSARPHSGGPSFGTDEEKKCMLLIMRVMSIVPLNSKQQPWSGPLSRELLVFNSF… |
| A0A2G4SP67 | 179-401 | VHTPWGKALHVSLKGDDVSRPMQEALLTALELIRFEVLTNKTFSKTYTRPLGNELEQKNIILLSRALSLLPIKLKNMQWLGPLNRDL… |
| A0A317XBK0 | 1-136 | None |
| H8X6Z5 | 502-796 | None |
| A0A0F8X2J2 | 498-722 | None |
| A0A7J6QGL2 | 179-454 | None |
| U9TB33 | 35-270 | None |
| A0A512U627 | 533-825 | None |
| A0A4Q1B8A0 | 292-528 | None |
| A0A6A5SDZ8 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.