DPCstruct | MC26580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 260 ± 38 aa |
| Standard deviation of domain lengths | 38.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409VJC5 | 6-293 | MGKYLRQIVDNPLEEGQFENAISVLDQLRSPDHTPSAIHLLHLIFIALHPASQSCRLDHPSALDPLLDNDDLIRQSPRKIVKQAKAT… |
| A0A067N097 | 14-302 | MPLGQRALVDTCFEEGHYESGIAVLDKLRSPKYYPSPSHVRQLIYIALYPPPLENAQTPDDLTSGSPKKLNIQRQKTHLLPTPESSV… |
| A0A1E3K7Z7 | 3-319 | None |
| A0A5N5QJS2 | 4-204 | None |
| K5UWQ0 | 1-215 | None |
| A0A836D9R6 | 134-379 | None |
| A0A0C2YWJ1 | 14-310 | None |
| A0A0C3JL93 | 14-300 | None |
| A0A4S4L7F7 | 6-257 | None |
| A0A2H3JNK7 | 286-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.