DPCstruct | MC2658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5B495 | 101-212 | WKQINTARNGKKVFGDWFVRVFSVGHIVKCPKYPKTHWVSIDTASIIHELLSIKELYGISCQQFMNLMQTVGEEKGLMSLDDVDLDD… |
| A0A2P6V8C1 | 2-114 | WRAMSAPDGLQRFTSWICALVLESSPERGSFPRHRKQQYVGRDAVAALHQLLRVRHTQSLDLQAFFDLLQRCGEERGLLELSNEAQD… |
| A0A7S3JL36 | 2-109 | None |
| A0A812J5D6 | 435-558 | None |
| A0A4Z1SU00 | 109-217 | None |
| I7LX14 | 93-213 | None |
| C1E6B0 | 886-1004 | None |
| L8GRK0 | 94-245 | None |
| B0EL96 | 26-136 | None |
| A0A7J7Q4F3 | 97-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.