DPCstruct | MC26579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 295 ± 26 aa |
| Standard deviation of domain lengths | 25.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067MS47 | 1-303 | MPPQKPPFPPSSLYDMEAAMKKTMSALRDDLQNRKADKKQVKLSCTYCGKVSESGKLATCSRCRSVRYCDATCQLKHFRASHKLDCK… |
| A0A4Q9MJR3 | 2-295 | TSKRRSGRSFHPGSPMDTFLASSEAGFESIEARINQGKEEERRRQEKCTYCQNESGDALKNCSRCKASRYCDEACQLADFKARHKRE… |
| A0A5C3Q1M1 | 18-249 | None |
| A0A6A4HWB3 | 28-344 | None |
| A0A6A4HS79 | 78-392 | None |
| A0A4Q9MHU6 | 1-287 | None |
| A0A550C0M2 | 1-340 | None |
| A0A2G8SPG9 | 1-293 | None |
| A0A371DXZ2 | 18-300 | None |
| D8QF19 | 48-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.