DPCstruct | MC26570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 86 ± 2 aa |
| Standard deviation of domain lengths | 2.44 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 94.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5YK92 | 355-440 | FAKRFGGATGEDEDYFRLLVEGIDAAGLSTGIVELMLADYRSADNSLDYVLDQWTYLDLSGFGAIKELAFGFESSDVGDFGINTPQ |
| A0A0F9SNJ5 | 121-205 | YAKKFGGVTGDDEDWFLLTITGFNGAVETGTVDFYLGDFRFADNGLDYIVDDWTWVDLTSLRAVTSLEFALSSSDVGGFGMNTPA |
| A0A4Q2YF01 | 158-245 | None |
| A0A7X8WCQ3 | 28-114 | None |
| A0A7G2M416 | 479-558 | None |
| A0A532UP20 | 140-225 | None |
| A0A6B2M2X0 | 134-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.