DPCstruct | MC2657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 309 ± 30 aa |
| Standard deviation of domain lengths | 30.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 40.79 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0001- PF03016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446SE37 | 1-296 | MCFCGPGTKYPDRPVAEACGFKTIVPAKPDDPKLTDWTTPDPDVFTTNSSKLGWCNVDPEDAYSSKVRFKEECHCKYDGLWGQFCET… |
| A0A087SC42 | 112-437 | TRLDPKVNLTEFRVEEGTEYHPIAGGRSSLCAGTCDDDISLCYCPSDTKYGRIPPGEHSLPGAPPIRKGRPMGQWCQPKQDKEGFPI… |
| A0A7S2D8V7 | 148-499 | None |
| A0A4U6T7W5 | 1-285 | None |
| A8J4Y8 | 914-1246 | None |
| A0A068UP91 | 2-323 | None |
| A0A1Z5SB56 | 137-461 | None |
| A0A835Y0G6 | 8-259 | None |
| Q10R19 | 13-336 | None |
| A0A835YJ46 | 5-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.