DPCstruct | MC26562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A547L5X1 | 9-102 | QRSPPADKELSYERDGRDAYGENNKSKRKAIPLFKARSNRQGRHGAKIAVAGMTGELRDADEAKLQAADFKASTPWKTKSPDIPLGD… |
| U5EJG6 | 2-103 | VRRSPQEKKALSYARDRRNCYGENDKSSRKNIPLRKRLRNRVDRRREGVFIGAVGAVDLVAAEQCEIDMLAKGRPSYWRKRPDLPLG… |
| A0A841C5Y1 | 1-98 | None |
| A0A146G9N4 | 1-92 | None |
| A0A1W1X7H2 | 1-107 | None |
| A0A059X5G3 | 1-100 | None |
| A0A544XD35 | 1-98 | None |
| A0A7H8MBE9 | 1-104 | None |
| A0A2V9MZT7 | 18-127 | None |
| A0A0D1EII6 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.