DPCstruct | MC26561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 163 ± 21 aa |
| Standard deviation of domain lengths | 21.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B2VTU5 | 60-189 | INSIKEVKKDCTKEICLLLLGDFNWRTRSVGAYFAAVQGYTDLIDIIGVHLLKSEVCYAGETYALVLAFFNTATGTQYLSRYLDHYL… |
| U5EBX7 | 1-179 | MQRWVIGEVVRPGRYMTLLGLNPLRDRPCRERLEAGLAADARQITDAELRLLLELDWRPRLTAAWLIALDRRTEFRGELAELLLADE… |
| A0A5N8V930 | 36-204 | None |
| A0A4Q2XLJ2 | 6-165 | None |
| A0A2V2QLV6 | 1-147 | None |
| A0A239H369 | 16-205 | None |
| A0A1H4L5D9 | 1-132 | None |
| A0A4R4QG13 | 14-181 | None |
| A0A1M6ZGS1 | 1-127 | None |
| A0A1M5A5N1 | 27-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.