DPCstruct | MC2656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 211 ± 29 aa |
| Standard deviation of domain lengths | 29.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5FX06 | 115-347 | RGLNKVRYCLPCIKESIDSVGYGYFRHFWDYSNECLIHGQPLNVLPDLGFSKTLKALKKLLNAKDCKQAIVLDAINSGDHRFSCNLP… |
| A0A259P2M8 | 15-210 | EEIVNVFPLESRTSSKKGAIAISYCFSCIKESIKNLGFGYFKADWLYGRKCTLHSSDLEILNTSNLKQTLEQLRFILAGIENVSQQK… |
| A0A5P9F0Z8 | 126-324 | None |
| A0A1B1NJU8 | 89-360 | None |
| A0A7Y8YBQ8 | 88-302 | None |
| A0A1L0BHC4 | 57-241 | None |
| A0A6G3L6Z6 | 79-329 | None |
| A0A2S8Q848 | 14-211 | None |
| A0A7D7X7U9 | 1-207 | None |
| A0A0D1FE70 | 4-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.