DPCstruct | MC26557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1WC80 | 2-81 | AASDVIPESLVQCLSDHSQSSQSISSVTYFPNNSSYTTVLHSYIRNLRFMSPTTPKPSFIIAPTHVSHLQASVICSKIHE |
| A0A4D9AR94 | 5-95 | TISLILLLILSCSLASSAAGDFLQCLSEKFDNYSSISNVVYTLNNSSYTSILKYSIFNLRFATNSTPKPQTIITPEHESQIPAIIHC… |
| A0A7N2L1V5 | 15-110 | None |
| A0A067KJP6 | 17-100 | None |
| A0A6P3ZRV0 | 11-104 | None |
| A0A3L6SLI9 | 5-113 | None |
| A0A4S4DWB0 | 32-116 | None |
| A0A142EGH2 | 1-92 | None |
| A0A453SET3 | 11-104 | None |
| A0A2U1LW99 | 37-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.