DPCstruct | MC26556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 366 ± 58 aa |
| Standard deviation of domain lengths | 58.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J8QFP9 | 79-450 | PAAILAQSEIWDEEKRSALEKPKFKKKDLDERRSKNLVPGTPLNPLRQDDRIPLLLIQRSLEAPSSTHGIHGWTLIFPAGWGMPFLS… |
| A0A0S3RVB6 | 45-412 | HGSSSTKVQSSRSCPILLLKNDVKELSIGWSVILPLSWVKAFWIPLISNGAHAIGLQEKHWITCEMGLPVFPSDFPDCKAYSCLMED… |
| A0A175W6B4 | 505-904 | None |
| A0A4Y9Y9P2 | 177-556 | None |
| A0A210PDN7 | 44-430 | None |
| A0A5N5QQP4 | 444-786 | None |
| A0A177TQU9 | 725-1242 | None |
| A0A1C6YIR8 | 451-888 | None |
| A0A5N6KPI2 | 391-663 | None |
| A0A3F2RXZ2 | 783-1094 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.