DPCstruct | MC26555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 498 ± 81 aa |
| Standard deviation of domain lengths | 80.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E3XJ39 | 93-512 | LELTGIEHTGRSIVLVFGDLLCQPLTHTNIQIYDAANWEAVYRTSHLPLIGKHPESKMRTFKCALAFQVGDHVISFNTLDFLFQVTW… |
| A0A166D0V2 | 13-480 | DLRLRSVAFAARNVILDFGSAWAQVQLFTHTNLQIYTRSEWYDTICLVDKNKRGFKIGIAFEFEEWVLAFPTMDFLICVYWRVDRES… |
| A0A0H2RVF6 | 136-581 | None |
| A0A4Y9ZX77 | 1-365 | None |
| J0WPR8 | 4-445 | None |
| A0A166FVM3 | 88-647 | None |
| A0A4Y9Z5F3 | 1-535 | None |
| A0A4Q9MAH0 | 1-639 | None |
| A0A4Y7U0V5 | 411-877 | None |
| S7QNV1 | 90-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.