DPCstruct | MC26550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 302 ± 47 aa |
| Standard deviation of domain lengths | 46.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0CPM4 | 421-713 | RVALGDRTQDIVYPFPIAGSAHRLCLAQKSRYIEVVVPTSRSLMPDGMKLNPFHVINSKGLLHAWSIHRVNLSALPVLDVKARNIKE… |
| A0A165WDT2 | 52-372 | TRFPLLLSRTGSSTAWNMHKLRLDGLPIIDEQIPSLSQEITTHLMLSLSDRERRIHDSGAGSGTQVGAKPARSPVSTSSQQIKDALV… |
| W9W381 | 597-924 | None |
| A0A0F4Z2Q0 | 606-952 | None |
| E9G4X0 | 19-299 | None |
| A0A6A5UTH8 | 829-1140 | None |
| A0A6A5V161 | 69-376 | None |
| R1GNQ5 | 10-286 | None |
| A0A6A6Z7W1 | 2-235 | None |
| A0A5K1K446 | 4-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.