DPCstruct | MC26549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7FE10 | 1-54 | MMRREEEEEGRVSSSLSSSRCQDCGNQAKKDCTYIRCRTCCKSRGFHCETHVKS |
| A2Q4P0 | 1-72 | MIFSLKAKEMEKNVFNPIRGEVLKGLKCQDCGNQAKKDCAYSRCRSCCKNKDFNCQTHIRTSEALGFLLIEN |
| G7JIL8 | 1-50 | None |
| A0A287WLZ4 | 75-151 | None |
| A0A6N2MDJ6 | 38-111 | None |
| A0A3Q0EN75 | 69-140 | None |
| A0A2P5XD56 | 61-124 | None |
| A0A6P6G040 | 128-191 | None |
| A0A022R8A6 | 184-267 | None |
| A0A199UHX1 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.