DPCstruct | MC26544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072TKW7 | 1-144 | MASSSSVSSIKINTYKSYVLKERTVTVPLNRLDVQVEAAVDFGSLERNGMDIKGYFAAQNMMDYFVMLNRLSYENLVKDFWVRAEVF… |
| A0A396JR03 | 1-124 | MASSSSVPETTMKEAPAYEIRGRTMSLEEWELNVQTANLVDFISLAFHGCELRRYYEAQDLMAYFNILNGPTYKNLVMHLWVRAQVY… |
| A0A2Z6NH26 | 1-149 | None |
| A0A072TKR1 | 1-146 | None |
| G7IWY1 | 1-124 | None |
| A0A072UWQ0 | 1-112 | None |
| A0A396HJQ6 | 1-145 | None |
| A0A2K3N6K3 | 1-138 | None |
| A0A396I9A8 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.