DPCstruct | MC26543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 205 ± 42 aa |
| Standard deviation of domain lengths | 42.04 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07899 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3CQ23 | 1-158 | MDGKNLQMFLNEGWKDHSSIGTEVAMALQRSGDPGKLVLDAMEGFYPPHLCKGDREFEGEVARRSCILLLEQLMELSPEIKPHVREN… |
| A0A396JGU1 | 28-205 | KALELKENQIEVQIKDLFDEEKEFDISNMDDQFSITIDGTSEEIGILDNLRESSDPAKLVLDIILNPTIPLPKKGDKAVIIDEGWIY… |
| Q851Y5 | 29-272 | None |
| A0A396HRZ9 | 260-484 | None |
| A0A1U8PXQ6 | 278-527 | None |
| A0A7N2L300 | 197-373 | None |
| A0A7J0GAS8 | 35-284 | None |
| A0A540KNM3 | 361-604 | None |
| A0A6A3BBR1 | 45-275 | None |
| A0A4S4F049 | 21-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.