DPCstruct | MC26541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 49.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396JEW2 | 1-151 | MPFQTDLAHQNPFTIALKNLGCKISDKETDVSVKISTATKILTPSQIEQEYHEWILEMHRKYDDEADAGEDKPVIVVNPANKEALGI… |
| K7MLE8 | 488-630 | KPTLSKTDLAHHNPFTAALKNFGNKFSEKEKDVTVEIRKATKVLTLLKLQMEYQDWILQMHHQYDEEADSGEDQPVIIVGPANEKAL… |
| A0A1S3YQQ7 | 161-306 | None |
| A0A453S3G0 | 266-412 | None |
| A0A453S2B7 | 1-175 | None |
| A0A061G2A5 | 200-348 | None |
| A0A287WZ02 | 174-371 | None |
| A0A540K8L6 | 489-622 | None |
| A0A2G5CJ87 | 180-329 | None |
| A0A315A603 | 512-671 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.