DPCstruct | MC2654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 164 ± 17 aa |
| Standard deviation of domain lengths | 17.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9J177 | 41-197 | SNQVEGDRRLLQFQSYEDYLDSFVTPTDLKYLRSTVAARAIAELGYRSSGETLSRELFHKRLKAVKESLYPSRKPYQLCSVNLHFDD… |
| A0A2K1KHK4 | 40-183 | MGTKKEDFPAFTTTQGIAIVNEFQSYEDYLDSQITLTDLFYLEDLELARQLVEIGYRSNAEVMSRDDFAQYKVKAEAARQATIVKVP… |
| A0A812RSR6 | 13-162 | None |
| A0A2R6XQ23 | 22-215 | None |
| A0A482VL84 | 12-167 | None |
| A0A6P5VNE1 | 83-245 | None |
| A0A556U836 | 239-402 | None |
| A0A812UWA7 | 696-864 | None |
| W6USW7 | 1-201 | None |
| A0A1D3D302 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.