DPCstruct | MC26539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 63.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446QQD2 | 4-109 | AADLVLKAACDACGKASELYSTACRHATLCNSCAATMARSRARCNVCAAPITNVIREYNVRVDTAAGKALSIAKFNTGVPPFSKMKG… |
| A0A396J7R5 | 1-108 | MNLQLKSSCCGCGVTTGLYGSNCKHMTLCSTCGKTMAKNRSKCSTCGTTLTRLIREYNVHASSATDKKYFLGRFMNGLPDFSKKKSA… |
| A0A835S4Q9 | 39-148 | None |
| A0A6A6LPA7 | 1-101 | None |
| A0A2Z6N2K8 | 442-529 | None |
| A0A5N5JPB1 | 1-115 | None |
| A0A0D2ZX91 | 1-112 | None |
| A0A445DJC5 | 1-106 | None |
| A0A3L6SFE7 | 1-120 | None |
| A0A7J6WPS0 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.