DPCstruct | MC26537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.82 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | CL0123- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0J8I0 | 67-182 | VQLGICAFRQGLIKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNAEQEKVEKRRQVPFHMHVNLELLECVYLVAAMLLEIPYMAA… |
| A0A396J6U2 | 3-135 | QLGLCAFRAGLISEAHECLSELYPGGRVRELLAQGVARSCYHEKTPEQELLERSRLMPYHMHINLELLESVYLISAMVLEVPNMAAN… |
| A0A7J9DGX7 | 58-203 | None |
| A0A376B2L8 | 606-797 | None |
| A0A820XGB2 | 154-286 | None |
| D8R7V3 | 12-152 | None |
| A0A7J9IPI3 | 241-382 | None |
| A0A553P924 | 626-745 | None |
| A0A835HKD4 | 120-273 | None |
| A0A835H4R5 | 46-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.