DPCstruct | MC26535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 16 aa |
| Standard deviation of domain lengths | 16.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4P5Q3 | 61-118 | GSHYCSVCRKSSLYKCYCCPKAFCRSCVVEESDDFAIVKGKKGFCSHCLQLAVMIEEK |
| A0A396J3W1 | 1-83 | MILGWHLCSNCEKNAHYLCYTCTFSLCKGCIKDAVMLCVRGNKGFCETCMRTVMLIEQNEEGNNMVYLLFLLPASFLVKCFYY |
| G7J7X4 | 59-128 | None |
| A0A2J6M3D7 | 45-120 | None |
| A0A5N5JNT1 | 11-69 | None |
| A0A396H854 | 64-152 | None |
| A0A4S4EYI7 | 63-118 | None |
| A0A7J7LS52 | 706-802 | None |
| A0A0B2Q4P4 | 58-139 | None |
| A0A124SFD4 | 194-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.