DPCstruct | MC26534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 15.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0GPY5 | 8-106 | TVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSF… |
| N1PDR0 | 15-102 | SLQHIRYQLIRLEDTVLYSLIERAQFPLNNTIYTPGAIPIHGSALSFSDWVLREQERLQSRIRRYQSPDEYPFFPDAMEDLILPPINY |
| A0A0C9X6U5 | 8-112 | None |
| A0A485KHY1 | 8-113 | None |
| A0A2P6N0Y2 | 3-105 | None |
| A0A4T0FZ80 | 7-96 | None |
| A0A2N9GZ43 | 58-166 | None |
| A0A1S4B4Q6 | 50-186 | None |
| A0A314UEP2 | 14-147 | None |
| A0A0A9M3H5 | 9-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.