DPCstruct | MC26533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 64.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02919 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183VKS4 | 12-82 | GYCILDGHKQRIGNFRIEPPGLFRGRGNHPKMGMLKKRIMPEDVIINCSKDSKVPAPPKGHRWKEVRHDNT |
| A0A396IZG1 | 33-93 | VGNFRVEPPGLFIGRGEHPKIGKVKRRIHPSDVSINIGKYTPIPECPIPGESWKEIKHKDT |
| A0A2V0PNI9 | 193-253 | None |
| A0A7N0U261 | 109-169 | None |
| A0A7J0G2H2 | 29-87 | None |
| A0A835H197 | 17-75 | None |
| A0A7R8W173 | 25-84 | None |
| D3DWJ7 | 71-147 | None |
| A0A1B7SL81 | 36-105 | None |
| A0A6B2LGK2 | 108-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.