DPCstruct | MC26531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 168 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 97.33 |
| Assigned Pfam label(s) | PF03126- PF01713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396ITN6 | 9-163 | DDNKAFKFPKQRNLNSATKSCQSAVSEKLPSGYAAIISSNLKLVYLKRTLIEELRKQPETFDDKVLGCFVRTKTDPNDYLQKNSHLL… |
| A0A7S4FHQ1 | 4-136 | TTPVQVEHIRRLQLTRKAMEMFIDDPEVEEIVKGCFVRVLVDKKTKDKVYRLSEVVGITYDSKYTLGDYGKTDKHMTLQYGDQISTC… |
| A0A3Q0JGL1 | 167-399 | None |
| A0A061R7K5 | 5-172 | None |
| A0A0A9E8C3 | 19-179 | None |
| A0A6J0NAS9 | 31-192 | None |
| A0A446K240 | 2-170 | None |
| A0A068USP6 | 125-300 | None |
| A0A396HCD7 | 165-329 | None |
| V7D0K6 | 319-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.