DPCstruct | MC2653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.32 |
| Pfam Score | 92.75 |
| Assigned Pfam label(s) | PF10785- PF12853 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1KHI8 | 84-177 | AMGIFLDEPKFPVIERNPTASSTISNFSFSDYVRIAAFTGGSLPVGYLAGGSVNIRGPSMYTAGIIGLMGGFMYAYQCSAGRLMGMF… |
| A0A1B9GXT8 | 3-103 | LKQTVQPYPLIDADPHFSRVVRYMRPSDYVTWAGATAAGPGLLWAFEKADPTRSTKASLRSALRLTGWLGFCAGFMLAYQRSTARFW… |
| R9P0Y7 | 54-155 | None |
| K8EA67 | 89-186 | None |
| A0A2P4YKI8 | 2-97 | None |
| C1MIP4 | 16-98 | None |
| A0A2P5EXJ3 | 48-131 | None |
| A0A7S2T8V2 | 67-152 | None |
| A0A1R2CR92 | 24-141 | None |
| A0A448ZTB7 | 15-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.