DPCstruct | MC26529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0GF04 | 81-200 | MAHLGRQLDLLPADWDTVLSDEDDALGTLAVEVTAALCEAGLALDDASGTGGVCLLPEAGLGGAVVSWRQHDRVSLDQVHGADADAL… |
| A0A7G1P991 | 13-151 | KKATPDEISRRCQLAERVRQDLSASGLTVHPADERGVTAAEGGGLEIELDDLDDAGGGVWLHWQLHTRTQDEVRAALRRGQADGPLS… |
| A0A7W8ZCN1 | 12-103 | None |
| A0A1Q9T4Q9 | 38-189 | None |
| A0A1I4CIR1 | 4-126 | None |
| A0A0N0NF42 | 97-223 | None |
| A0A1V2I019 | 156-279 | None |
| A0A6B2UM69 | 5-119 | None |
| A0A1Q5MNN7 | 9-128 | None |
| A0A4S8QAK8 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.