DPCstruct | MC26526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9Z4D4 | 149-238 | YIEQLEVNERYRGRGIGRWAVYNILANPIFAECQYIFAWPNVLGSGTPFDPADEHYMTKKAGIISFWRKLGFRRVGGTYFFGYARDP… |
| A0A561SDW5 | 3-113 | PCKAVQRARQVVRWVPTFLLESVEVKDDWRGKGVGMRLAVEALRRLAVPRTLAVCYPAPIHDHGPDEPCAYESDDPEVRRPDEEAVE… |
| I9KRL7 | 134-216 | None |
| A0A0M8XXQ9 | 2-105 | None |
| A0A1H5J997 | 17-111 | None |
| A0A5B1QUE8 | 149-238 | None |
| A0A4Y9ZQ05 | 403-503 | None |
| A0A511Y361 | 36-146 | None |
| A0A0L6JX47 | 119-212 | None |
| A0A1S6LPX9 | 6-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.