DPCstruct | MC26521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9CW04 | 168-223 | PAFAWLKCEGDIEDCESFLRDHKILTRSGKHFGTSPKFVRISMLDQDSNYDLFIER |
| A0A438IDT4 | 4-60 | YAWFKCEREEDKECYTVLKEAGIIGREGNLYGAETSYVRLSLLKSQDDFDALLHQIN |
| A0A2N9IMP5 | 151-218 | None |
| A0A2I0HUS9 | 81-138 | None |
| A0A0L9VKI9 | 340-399 | None |
| A0A068UT02 | 15-69 | None |
| A0A0D9V4Z5 | 892-958 | None |
| A0A251SQC7 | 37-91 | None |
| A0A438DPI0 | 212-267 | None |
| A0A1D6LZP4 | 229-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.