DPCstruct | MC2652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 171 ± 24 aa |
| Standard deviation of domain lengths | 24.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0RHF0 | 1-146 | MAGQLYTVTYTVGLIDKLAGIKKPEKADAKTSPGASQPVMLHPELLAMKQQDRSLAHALARSKRVGDALLKAEEEELSKIQALEGEL… |
| A0A2K1K6V3 | 1-182 | MAPANNAFSLQVTNELVQKLAKENIVAKRPARKAPAPKPSVKPLEAPLVTKQGLPLPFYRGFLSGVPGINKEQAYQQSQEQKHDLVP… |
| A0A7R9FQM9 | 1-206 | None |
| A0A7S1SYS0 | 1-139 | None |
| A0A7S0J8I3 | 1-157 | None |
| A0A1Y1IDZ4 | 44-218 | None |
| A0A7R9M1U8 | 1-206 | None |
| A0A383VMU1 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.