DPCstruct | MC26518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 178 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6M1A4 | 128-308 | SLPPSAAEVQRTECLRSLREVATSLSERPARGDLTGEVCHWADGYHLNVALYEKMLGSVFDILDEGKLTEEAEEILELLRSTWRTLG… |
| A0A438I8N7 | 1-199 | MLTSHAFSLPPSTGGLQRTECLRSLREIAIPLAERPARGDLTGEVCHWADGYHLNVRLYEKLLLSVFDILDEGKLTEEVEEILELLK… |
| A0A2T7CYW2 | 324-504 | None |
| A0A287HTC5 | 128-308 | None |
| A0A0A9DUI8 | 35-210 | None |
| U5DD15 | 330-504 | None |
| A0A0P0WDQ1 | 1-202 | None |
| A0A0D2TDU3 | 5-178 | None |
| A0A438C2C3 | 2-156 | None |
| A0A446SHG5 | 6-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.