DPCstruct | MC26517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 52.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426Y411 | 1-70 | MFADACCVGEKKVNGEDCFVLKLSADPQTLRARSEGPAEIIRHVLFGYFSQRTGLLVHMEDSHLTRIQAN |
| M1CL43 | 1-69 | MFSDSICIGEKPVHGEDCFVLKFEAEPSSLKARSSSNVEIMRHTVWGYFSQRTGLLVQLEDSHLLRLKS |
| A0A834WW17 | 4-82 | None |
| A0A0D9VPY4 | 2-83 | None |
| A0A5P1FER8 | 4-90 | None |
| A0A7J7M057 | 23-108 | None |
| A0A1U8KSH6 | 1-70 | None |
| A0A2K3MWD4 | 1-64 | None |
| A0A6A6KKV1 | 3-77 | None |
| A0A2P5D327 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.