DPCstruct | MC26516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418AUC8 | 4-81 | ATITIDDYFERAKEFRVWLKLEKNVCFDDLTSTDAITYFDKFVTKWNANRLDSMYYTSIPQHILESIQRTQHKWGFKM |
| A0A438HYW3 | 1-86 | MLLNFGWHRILEFQELSNDDYFSKNNEFAAWLKEKRKIYFADLSTESARELFTEFVKDWNKQKLESKYYEGIVTGPRTSHKWNIKQ |
| A0A1X7USS5 | 17-125 | None |
| A0A3L6QI29 | 348-429 | None |
| A0A2G8SBW2 | 171-276 | None |
| A0A0D3GI94 | 13-99 | None |
| A0A2T9ZFC2 | 1-106 | None |
| A0A2I4FEB4 | 118-198 | None |
| I1KTZ9 | 69-151 | None |
| A0A1S3BG35 | 62-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.