DPCstruct | MC26515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6QLD2 | 171-337 | LQHAVSGLEPLSWSEDHRVSVSTARSIAVLELICDVHSPGQDLVIHRTSVPAPANSCLLKVGSKKEVVECKEKFATSKDPTVSQSFM… |
| A0A438HX68 | 3-165 | SRFQAASLVASPSYPNAVAWSDENLIAVATGHLVTILNPALPFGPRGLITIPANKPFPIGVIERQDLYSGCLLSTCLSRDIRPCVRS… |
| A0A6S7NS16 | 54-200 | None |
| A0A1V8SKY6 | 12-145 | None |
| A0A1D6GED9 | 1-170 | None |
| A0A0B7FZQ7 | 1-142 | None |
| M2PRE4 | 13-151 | None |
| A0A2T7A9E8 | 9-145 | None |
| A0A2T0FFS5 | 16-128 | None |
| A0A7J7QAS4 | 30-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.