DPCstruct | MC26514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438HRH3 | 1-72 | MSGIIPDSLGQLSSLVVLELNENSWEGVITEAHFSNLSSLKQLSITKSSPNVSLVFNISSDWAPPFKLTYIN |
| A0A314XT50 | 69-130 | MGSVPENIGQMSKLEAIDFSGNSLEGVISEIHFSKLSYLWVLDLSSNSLVLNFSFDWVPPFQ |
| A0A5N5F0V1 | 124-192 | None |
| A0A443PRA9 | 185-254 | None |
| A0A4Y1R0B6 | 218-285 | None |
| A0A498KKT7 | 524-592 | None |
| A0A498K4L0 | 75-148 | None |
| A0A7J9B481 | 54-117 | None |
| A0A445GJT1 | 78-140 | None |
| A0A396J6J2 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.