DPCstruct | MC26512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11443 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4F075 | 192-276 | YRVRDRLRKEVLVPLRKELQLPEVYMGANQWGAIPYNRVASVAMKLYKSKFLEHDNERFNKYLEDVKAGKSTIAAGALLPHEIIA |
| A0A803MN08 | 194-278 | FKVRDRLRKEVLVPLRKALDLPEVYISAMKWDTLPYNKVPSVAMKLYKTLFYKHDEERFVEYLEKVKIGKATIAAGALLPHEIIA |
| A0A1E5VFI4 | 306-389 | None |
| A0A2P5F1Z9 | 364-454 | None |
| A0A835LLH6 | 5-90 | None |
| A0A804P993 | 60-149 | None |
| A0A811SC28 | 230-309 | None |
| W1P3H7 | 290-389 | None |
| E9H3M6 | 354-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.