DPCstruct | MC26510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 241 ± 49 aa |
| Standard deviation of domain lengths | 49.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0H8G6 | 16-307 | HGFVAFKRYTSRLGPQFAGAITYFSVLSMVPILLFSFALLGLTVTVLRPDLMDVITTTIASALSNNAFPDELSESILSLVVGALQGW… |
| A0A0Q4G6U5 | 28-238 | IVAILPVSAQHLVAANLNRGLASGRGGIVTLIVSLGIALFSARRAGRSLLHGINLAYLIERERRGLRRQLVSTVVVLGCAALVLTAL… |
| A0A1J4XA34 | 17-281 | None |
| A0A2T0K3H4 | 16-300 | None |
| A0A0R3NC66 | 3-164 | None |
| A0A7K3DI87 | 34-332 | None |
| A0A2V7Y6U7 | 11-258 | None |
| W5WA97 | 5-299 | None |
| A0A7K0ZYQ1 | 5-214 | None |
| A0A7V3AAQ2 | 7-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.