DPCstruct | MC2651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 185 ± 27 aa |
| Standard deviation of domain lengths | 26.68 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834D430 | 3-181 | KRKGDLDAAIKRLHDILLGSSASATVDESNPSHQKKVASPGNPLALMKNLPNEGAEFIELLIKELTNAKSVEDAKDRAAKLLGSSEK… |
| A0A2K1JUH3 | 36-209 | SPSHGERVSLASEADGATSSSNHGDMDSSGHASSPVQSEMDAWLEHLVKEMLAARDINDAHVRGKYALEAVEKAVSTRSAAAMEVLQ… |
| A0A1W0VYE4 | 10-186 | None |
| A0A4U5PPG8 | 73-284 | None |
| A0A7R9T6V5 | 1-163 | None |
| K3ZTW9 | 194-403 | None |
| A0A453T758 | 8-201 | None |
| A0A7S0DEJ9 | 37-186 | None |
| A0A426Y396 | 35-199 | None |
| A0A7N2M5H7 | 27-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.