DPCstruct | MC26509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 285 ± 32 aa |
| Standard deviation of domain lengths | 32.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6T9E8 | 46-301 | TSGEPSLPTRNVLYEHGLFEAFDERPAAAIAALHRAMVAAQGDQDMLFALAELSFLHGQATKKKDYYLAAAVYAYAFLFPEKAGDPG… |
| A0A0T5PFJ6 | 1-338 | MRYLAILVILLHLAGCSNTRFIKLEQTAAPALDPVTSLLAYRFISLQQQDAASIAGYCQALRDQSPSSQLYLLQLACAERWLAQPLS… |
| A0A518I4A2 | 21-293 | None |
| A0A5Q3L8H4 | 81-382 | None |
| A0A109LAX0 | 48-336 | None |
| A0A7W9WP58 | 19-360 | None |
| A0A2V6GNL4 | 39-290 | None |
| A0A855HR15 | 1-261 | None |
| A0A1G0ZK23 | 74-336 | None |
| A0A2E0QU33 | 47-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.