DPCstruct | MC26508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 270 ± 30 aa |
| Standard deviation of domain lengths | 29.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C2BX95 | 19-287 | KAPTCEFGPDGGEFTDVRSDKPLELHGDWAHVFRQFKLDPDEFELLDDTIRCSTWQQSARAKDGSRDAVQLYSYRARFRKRAQTALP… |
| A0A242D161 | 1-207 | MAFYQKDSKTPEDILKYKGYDPQEWEISQVTTNEWTTTTADIQKWNQQLKFVVKPKHKAFNASAFTESIEPVKLTAIKTGDRNLFIG… |
| A0A497N3N8 | 9-300 | None |
| Q5YSR2 | 11-267 | None |
| A0A7X3I6F5 | 23-258 | None |
| A0A238VWS2 | 100-385 | None |
| A0A832RBX7 | 172-458 | None |
| A0A7C6IIJ0 | 69-381 | None |
| E3NSU7 | 19-309 | None |
| A0A2E9VXG5 | 9-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.