DPCstruct | MC2650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 219 ± 35 aa |
| Standard deviation of domain lengths | 34.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433V4B1 | 4-163 | EVYLLFENLLFFAIATSFFALVGWAWRHSKPFYLPEPLPEWFKIWFGTVQIIGLLLPIAALLWGIWQGYSSILTVLIPYLVMLGLQI… |
| A0A2K1JS01 | 23-243 | VDENVSDFGGLGGVMGSFRVIELQLMAFIVVFSASGLVPLIDILFPVVISIYAVVIGKLVFPRYKNAELSVFKGNRVFQAYVIFGTL… |
| A0A484KLA7 | 49-280 | None |
| A0A7S1ZXM5 | 3-253 | None |
| A0A7S2HNC2 | 64-303 | None |
| A0A388KWS3 | 146-408 | None |
| A0A443N102 | 16-256 | None |
| A0A7J0ECH8 | 1-226 | None |
| A0A6A6N4T7 | 531-759 | None |
| A0A7J6E6X4 | 15-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.