DPCstruct | MC265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1W802 | 7-135 | ADKFEDVAWVLQDPIINFSQHVVDQSIEENCRFQAKAGLSPKITRRLSGRACKWCINLAGFYDYFDKPDDIYRRHENCRCTVEYYPG… |
| A0A143Y9L4 | 137-247 | EKVKWLLDEPIVNFSQSIVDDAIRANATFHAKAGLRPKITRRVSGRACDWCQKLAGTYDYGGEPKDVYRRHERCRCTVDYNPGEGKR… |
| E6UID0 | 2-123 | None |
| A0A1H9BV38 | 58-178 | None |
| A0A2A5RIM3 | 57-175 | None |
| A0A2S0L5J0 | 11-125 | None |
| A0A7X2N3U5 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.