DPCstruct | MC26499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 193 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6NE15 | 1-190 | MGKECERGEILPGEVVVSILNSMYPLGPAVPVKFLRAAIVFCHDHDWIHMKNQLEQNLLQQPPKTWEEYRDQIIFAERFKLENMLAT… |
| A0A0N4XK69 | 74-242 | AFFTREMEDECARGGLLPGEVLVALLSSMYPLGPQVPSQFLRAAIVFCHDHEWIHMKNKLEQWLLQQPPDSYEAYRDQIIFAERFRL… |
| A0A0B2UUC2 | 390-592 | None |
| A0A0N4WCZ4 | 474-663 | None |
| A0A6V7WT84 | 2-200 | None |
| A0A811K6B3 | 73-300 | None |
| A0A811L686 | 190-370 | None |
| A0A0M3IIG0 | 291-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.