DPCstruct | MC26494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1W1G4 | 31-161 | QDLGSVNYTMPSGPWYWPWCPLWRTPQHPIFQLSNILFVASYCAPSTKKGQLWMHTILIFGFMLYSVWSWHVICAPDAFSWNFAFVF… |
| A0A423T0D3 | 72-199 | LSVGRAFYLPTDVPSLLSGSLLSCDVWTSPQHLLFQLANGCFFVSYLAPSQRKGLLFMHGILILGFLLYSTWAWNIICAPDVFSWNF… |
| S4RDG3 | 1-137 | None |
| A0A5J5CZD1 | 1-157 | None |
| A0A3Q0IVC5 | 32-140 | None |
| A0A1A9UE33 | 102-218 | None |
| A0A7E4RU17 | 23-155 | None |
| W5JMW7 | 195-340 | None |
| F6ZS78 | 30-203 | None |
| A0A6A4WAN4 | 4-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.