DPCstruct | MC26493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 18.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423SUH8 | 12-138 | VSYFAAGIVAHLVCAGHDSWDESGISKEDLLEELGKVVTSWEQPKDEMVAYRSFQPFIPLLTALNMHQVQLWAVWALHHVTTKNSKR… |
| A0A2U3Z1Q1 | 28-167 | SNLLESKADGIEVSYNACGVLSHIMFDGPEAWGICEPQREEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATW… |
| L9KLK1 | 669-820 | None |
| A0A4Z2DI96 | 223-389 | None |
| A0A654HIU9 | 204-357 | None |
| A0A672Q920 | 406-547 | None |
| T1GPQ1 | 32-158 | None |
| A0A2H2JHR5 | 23-163 | None |
| A0A6G3MGR4 | 148-299 | None |
| A0A7I8VJA4 | 328-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.