DPCstruct | MC26492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3EKU5 | 35-134 | KVMMSESAMKFVTPLTFQALSRHDVYTDTFDEKDSAVIAHIDLADWADVVLVAPATANCIGKLAGGIADDMITTTLLATAAPVWIAP… |
| A0A6J5Y2H4 | 1-62 | MGDSVLHIELRCWADIMVIASLSANTLSKIAKGLCDNLLTCVVHAWDYSKPFFVAPAMNTLL |
| A0A3C0MZG8 | 38-124 | None |
| A0A7V2LVR5 | 42-127 | None |
| A0A0A6VHU0 | 1-76 | None |
| A0A3A8V4F6 | 135-236 | None |
| A6ZZN0 | 1-94 | None |
| I1BL49 | 28-97 | None |
| A0A0C2XIN5 | 13-84 | None |
| A0A7S0GGJ6 | 11-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.