DPCstruct | MC2649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 70.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804R612 | 184-238 | PNVQLEQGTVTSLLEENGTVKGVQYKTKSGEELKAYAPLTIVCDGCFSNLRRALC |
| A0A2U1P6U0 | 67-121 | KLEQGTMTSLLEEKGAFKGVRYKTKGGLDIIANATLTIACYGCFSNLRRGLCKPE |
| A0A2U1NLU1 | 175-236 | None |
| A0A2P5XK41 | 77-131 | None |
| A0A2R6R216 | 7-66 | None |
| U7DUS7 | 169-223 | None |
| A0A2P5YER4 | 617-676 | None |
| A0A4D6KU56 | 156-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.