DPCstruct | MC26485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 177 ± 36 aa |
| Standard deviation of domain lengths | 36.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059Y4T0 | 32-157 | NDIWEKWSYGEIFEKLKSKIPDSKLELVSKPDIKPTPDSTNPPFVIKLNNSNQKLELPFGKVWPISSETKYNGNEATSIGYTEDGKI… |
| Q6MSJ9 | 2-153 | FKDQKDAFGSFHTHQEVLDQLKVYLNDSKIKHLDHLKLTNENEKNTNLKVDTEHKKLNSVSLSFFDKKITFTPNTVLENKVQTKYSN… |
| N9UAU9 | 782-974 | None |
| N9VA55 | 124-302 | None |
| A0A7U0XNH5 | 295-493 | None |
| A0A7Z7LB98 | 4-150 | None |
| A0A2K8P2X0 | 130-355 | None |
| S6G3U8 | 350-591 | None |
| A0A7U5AZR8 | 18-200 | None |
| A0A059Y3S7 | 27-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.