DPCstruct | MC26483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 199 ± 42 aa |
| Standard deviation of domain lengths | 41.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A266NBP5 | 5-213 | IKDKDTAPVIDFVNVEQLDRLQRIIRLQRWTNIPYTEIKTFVHCVASAGAEVNTFTINDNTLRALGVYRYLSQRYTVSVEEFSAMVH… |
| A0A379RZY6 | 180-344 | LQRWLGLSFEEVDLLLNACIRGQGSQNSDNSLNAQTLRMLGVYRHWQQAYQVTAFQFAAILYQITPYAISPAVPFLDQIFNTTSAFD… |
| A0A1H5EYN8 | 330-563 | None |
| A0A089PXI1 | 299-517 | None |
| A0A109LLE5 | 164-398 | None |
| A0A6G6ETA1 | 433-674 | None |
| A0A3M3ZFI0 | 286-597 | None |
| A0A1H0MPB9 | 358-611 | None |
| A0A6G1W5D0 | 391-623 | None |
| A0A0L0LVQ0 | 50-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.