DPCstruct | MC2648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 186 ± 40 aa |
| Standard deviation of domain lengths | 40.27 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 87.75 |
| Assigned Pfam label(s) | CL0425- CL0266- PF19530- PF00662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520K562 | 8-171 | KSLLMGYIFALAGGAAILYAISTVKEAGQYVCALLYMGSALGAIFAGDFFTLYIFWEIMAFSSLGLIWYEGSRRARDAGMRYILFHL… |
| A0A2G3DGW4 | 26-175 | YIECTEMAITEFLLFVLAATLGGIFLCGANNLIRMFQAPECFSLCSYLLSGYTKKDVRSNEATMKYLLMGGASSSILVHGFSWLYGS… |
| A0A4T0E3H3 | 67-249 | None |
| A0A535AI42 | 1-205 | None |
| A0A2H9T822 | 7-228 | None |
| A0A7C7HXR3 | 2-118 | None |
| Q9TD60 | 1-144 | None |
| A0A381GJB3 | 11-198 | None |
| A0A832C8P6 | 49-297 | None |
| V9P4U4 | 62-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.