DPCstruct | MC26479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 304 ± 32 aa |
| Standard deviation of domain lengths | 32.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8BMU5 | 22-280 | SLMIYDNRGQALGYLDRMAKWKFAPGSNIEMAGIRNPHLKRMVTYIHDRGTGFLKEFISAVDNALENIEPENFAQHQSLALLMGRPL… |
| A0A537KUW3 | 1-362 | MLRFNWLAANGDVITSGTQPTSTPICGWVVPNYLDVSLMAYDADGAALGSVARVDDQIKWLAAPTRPNAFGETDPAAKNGHLNNFLN… |
| A0A6M0A004 | 577-880 | None |
| A0A2R7S9X0 | 533-833 | None |
| A0A1B7XQB5 | 275-634 | None |
| A0A2V4DGG1 | 727-1027 | None |
| Q094A7 | 779-1114 | None |
| A0A3R6RFA8 | 792-1067 | None |
| B8LXQ5 | 1-283 | None |
| A0A0C2JMM9 | 399-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.